A8475
PTPRU Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A8475
- Additional Names:
- FMI|hPTP-J|PCP-2|PTP|PTP-J|PTP-PI|PTP-RO|PTPPSI|PTPRO|PTPRU|PTPU2|R-PTP-PSI|R-PTP-U
- Application:
- ELISA, WB
- Molecular Weight:
- 100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MARAQALVLALTFQLCAPETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCV
- Uniprot:
- Q92729
- Synonyms:
- FMI;hPTP-J;pancreatic carcinoma phosphatase 2;PCP-2;pi R-PTP-Psi;protein-tyrosine phosphatase J;protein-tyrosine phosphatase pi;protein-tyrosine phosphatase receptor omicron;PTP;PTP pi;PTP-J;PTP-PI;PTP-RO;PTPPSI;PTPRO;PTPU2;R-PTP-PSI;R-PTP-U;Receptor protein tyrosine phosphatase hPTP-J;receptor-type protein-tyrosine phosphatase psi;receptor-type tyrosine-protein phosphatase U
- Extra Details:
- The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracellular catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains a meprin-A5 antigen-PTP (MAM) domain, Ig-like and fibronectin type III-like repeats. This PTP was thought to play roles in cell-cell recognition and adhesion. Studies of the similar gene in mice suggested the role of this PTP in early neural development. The expression of this gene was reported to be regulated by phorbol myristate acetate (PMA) or calcium ionophore in Jurkat T lymphoma cells. Alternatively spliced transcript variants have been reported.
- Shipping Conditions:
- Blue Ice

