CHRNA6 Rabbit polyclonal antibody

Size

£151.00

SKU:: A8470
Additional Names:: CHNRA6|CHRNA6
Application:: ELISA, WB
Molecular Weight:: 57kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVVENSEHSPEVEDVINSVQFIA
Uniprot:: Q15825
Synonyms:: acetylcholine receptor, nicotinic, alpha 6 (neuronal);CHNRA6;cholinergic receptor, nicotinic alpha 6;cholinergic receptor, nicotinic, alpha 6 (neuronal);cholinergic receptor, nicotinic, alpha polypeptide 6;neuronal acetylcholine receptor subunit alpha-6
Extra Details:: This gene encodes an alpha subunit of neuronal nicotinic acetylcholine receptors. These receptors consist of five subunits and function as ion channels involved in neurotransmission. The encoded protein is a subunit of neuronal nicotinic acetylcholine receptors that mediate dopaminergic neurotransmission and are activated by acetylcholine and exogenous nicotine. Alternatively spliced transcript variants have been observed for this gene. Single nucleotide polymorphisms in this gene have been associated with both nicotine and alcohol dependence.