A8452
SLCO1A2 Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A8452
- Additional Names:
- OATP|OATP-A|OATP1A2|SLC21A3|SLCO1A2
- Application:
- ELISA, WB
- Molecular Weight:
- 74kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LLYFLSFLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYIYLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTVLKDDELKTKL
- Uniprot:
- P46721
- Synonyms:
- OATP;OATP-1;OATP-A;OATP1A2;organic anion transporting polypeptide A;organic anion-transporting polypeptide 1;SLC21A3;sodium-independent organic anion transporter;solute carrier family 21 (organic anion transporter), member 3;solute carrier family 21 member 3;solute carrier organic anion transporter family member 1A2
- Extra Details:
- This gene encodes a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers. Alternative splicing of this gene results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

