A8440
CEACAM6 Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A8440
- Additional Names:
- CD66c|CEACAM6|CEAL|NCA
- Application:
- ELISA, WB
- Molecular Weight:
- 50-200kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
- Uniprot:
- P40199
- Synonyms:
- carcinoembryonic antigen related cell adhesion molecule 6;carcinoembryonic antigen-related cell adhesion molecule 6;carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen);CD66c;CEAL;Cluster of Differentiation 66c;NCA;Non-specific crossreacting antigen;normal cross-reacting antigen
- Extra Details:
- This gene encodes a protein that belongs to the carcinoembryonic antigen (CEA) family whose members are glycosyl phosphatidyl inositol (GPI) anchored cell surface glycoproteins. Members of this family play a role in cell adhesion and are widely used as tumor markers in serum immunoassay determinations of carcinoma. This gene affects the sensitivity of tumor cells to adenovirus infection. The protein encoded by this gene acts as a receptor for adherent-invasive E. coli adhesion to the surface of ileal epithelial cells in patients with Crohn's disease. This gene is clustered with genes and pseudogenes of the cell adhesion molecules subgroup of the CEA family on chromosome 19.
- Shipping Conditions:
- Blue Ice

_WB_01.jpg)