MEIS2 Rabbit polyclonal antibody

Size

£151.00

SKU:: A8437
Additional Names:: CPCMR|HsT18361|MEIS2|MRG1
Application:: ELISA, WB
Molecular Weight:: 50kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ
Uniprot:: O14770
Synonyms:: CPCMR;homeobox protein Meis2;HsT18361;Meis homolog 2;Meis1-related gene 1;meis1-related protein 1;Meis1, myeloid ecotropic viral integration site 1 homolog 2;MRG1;TALE homeobox protein Meis2
Extra Details:: This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene.