GNB2 Rabbit polyclonal antibody

Size

£151.00

SKU:: A8422
Additional Names:: GNB2|HG2C1|NEDHYDF|SSS4
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 37kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Uniprot:: P62879
Synonyms:: epididymis secretory sperm binding protein;g protein subunit beta-2;G protein, beta-2 subunit;guanine nucleotide binding protein (G protein), beta polypeptide 2;guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2;guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2;signal-transducing guanine nucleotide-binding regulatory protein beta subunit;SSS4;SSS4; NEDHYDF;transducin beta chain 2
Extra Details:: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5' UTR.

Shipping Conditions:: Blue Ice