A8416
ESRRB Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A8416
- Additional Names:
- DFNB35|ERR beta-2|ERR2|ERRb|ERRbeta2|ESRL2|ESRRB|NR3B2
- Application:
- ELISA, WB
- Molecular Weight:
- 56kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSNSPGIPNPRPSSPTPLNERGRQISPSTRTPGGQGKHLWLTM
- Uniprot:
- O95718
- Synonyms:
- DFNB35;ERR beta-2;ERR2;ERRb;ERRbeta2;ESRL2;estrogen receptor-like 2;estrogen-related nuclear receptor beta;Estrogen-related receptor beta;NR3B2;nuclear receptor ERRB2;nuclear receptor subfamily 3 group B member 2;orphan nuclear receptor;steroid hormone receptor ERR2
- Extra Details:
- This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development.
- Shipping Conditions:
- Blue Ice