A8409
CRHR1 Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A8409
- Additional Names:
- CRF-R|CRF-R-1|CRF-R1|CRF1|CRFR-1|CRFR1|CRH-R-1|CRH-R1|CRHR|CRHR1|CRHR1L
- Application:
- ELISA, WB
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
- Uniprot:
- P34998
- Synonyms:
- corticotropin-releasing factor receptor 1;corticotropin-releasing factor type 1 receptor;Corticotropin-releasing hormone receptor 1;CRF-R;CRF-R-1;CRF-R1;CRF1;CRFR-1;CRFR1;CRH-R-1;CRH-R1;CRHR;CRHR1-IT1-CRHR1;CRHR1-IT1-CRHR1 protein;CRHR1-IT1-CRHR1 readthrough;CRHR1L;MGC57346-CRHR1;seven transmembrane helix receptor
- Extra Details:
- This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal transduction pathways that regulate diverse physiological processes including stress, reproduction, immune response and obesity. Alternative splicing results in multiple transcript variants. Naturally-occurring readthrough transcription between this gene and upstream GeneID:147081 results in transcripts that encode isoforms that share similarity with the products of this gene.
- Shipping Conditions:
- Blue Ice

