ATP7A Rabbit polyclonal antibody

Size

£151.00

SKU:: A8399
Additional Names:: ATP7A|DSMAX|MK|MNK|SMAX3
Application:: ELISA, WB
Molecular Weight:: 140-180 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MDPSMGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNPD
Uniprot:: Q04656
Synonyms:: ATPase, Cu++ transporting, alpha polypeptide;copper pump 1;copper-transporting ATPase 1;Cu++-transporting P-type ATPase;DSMAX;Menkes disease-associated protein;MK;MNK;SMAX3
Extra Details:: This gene encodes a transmembrane protein that functions in copper transport across membranes. This protein is localized to the trans Golgi network, where it is predicted to supply copper to copper-dependent enzymes in the secretory pathway. It relocalizes to the plasma membrane under conditions of elevated extracellular copper, and functions in the efflux of copper from cells. Mutations in this gene are associated with Menkes disease, X-linked distal spinal muscular atrophy, and occipital horn syndrome. Alternatively-spliced transcript variants have been observed.