A8381
UBE2NL Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A8381
- Additional Names:
- Li174|UBE2NL
- Application:
- ELISA, WB
- Molecular Weight:
- 17kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPAL
- Uniprot:
- Q5JXB2
- Synonyms:
- epididymis tissue protein Li 174;Li174;putative ubiquitin-conjugating enzyme E2 N-like;ubiquitin conjugating enzyme E2N-like
- Extra Details:
- This gene is intronless and encodes a member of the ubiquitin-conjugating enzyme family. The protein product is 91% identical to ubiquitin-conjugating enzyme E2N, a multi-exon gene product. This locus represents a polymorphic pseudogene, where some individuals contain an allele that can encode a full-length protein, while others have a non-functional allele containing a premature stop codon (reference SNP rs237520) that truncates the coding sequence.
- Shipping Conditions:
- Blue Ice