A8374
TAMM41 Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A8374
- Additional Names:
- C3orf31|COXPD56|RAM41|TAM41|TAMM41
- Application:
- ELISA, WB
- Molecular Weight:
- 38kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFLKVLGPKIITSIQNNYGAGVYYNSLIMCNGRLIKYGVISTNVLIEDLLNWNNLYIAGRLQKPVKIISVNEDVTLRSALDRNLKSAVTAAFLMLPESFSEEDLFIEIAGLSYSGDFRMVVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPEGQFTQLMTLPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLKKSVIYSSLKLHKMWKGWLRKTS
- Uniprot:
- Q96BW9
- Synonyms:
- C3orf31;CDP-DAG synthase;CDP-diacylglycerol synthase;mitochondrial translocator assembly and maintenance protein 41 homolog;MMP37-like protein, mitochondrial;phosphatidate cytidylyltransferase, mitochondrial;RAM41;TAM41;TAM41, mitochondrial translocator assembly and maintenance protein, homolog
- Extra Details:
- Predicted to enable phosphatidate cytidylyltransferase activity. Predicted to be involved in CDP-diacylglycerol biosynthetic process and cardiolipin biosynthetic process. Predicted to be located in mitochondrial inner membrane. Predicted to be extrinsic component of mitochondrial inner membrane. Predicted to be active in mitochondrion.
- Shipping Conditions:
- Blue Ice

