A8353
HLTF Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A8353
- Additional Names:
- HIP116|HIP116A|HLTF|HLTF1|RNF80|SMARCA3|SNF2L3|ZBU1
- Application:
- ELISA, WB
- Molecular Weight:
- 114kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VSSNGPSGNDTPEELRKKLIRKMKLILSSGSDEECAICLDSLTVPVITHCAHVFCKPCICQVIQNEQPHAKCPLCRNDIHEDNLLECPPEELARDSEKKSDMEWTSSSKINALMHALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVESIQCFQNTEAGSPTIMLLSLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL
- Uniprot:
- Q14527
- Synonyms:
- DNA-binding protein/plasminogen activator inhibitor 1 regulator;DNA-binding protein/plasminogen activator inhibitor-1 regulator;helicase-like transcription factor;HIP116;HIP116A;HLTF1;RING finger protein 80;RING-type E3 ubiquitin transferase HLTF;RNF80;SMARCA3;SNF2-like 3;SNF2L3;sucrose nonfermenting protein 2-like 3;sucrose nonfermenting-like 3;SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 3;SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3;ZBU1
- Extra Details:
- This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein.
- Shipping Conditions:
- Blue Ice

