A8352
RPN2 Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A8352
- Additional Names:
- RIBIIR|RPN-II|RPN2|RPNII|SWP1
- Application:
- ELISA, WB
- Molecular Weight:
- 69kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTV
- Uniprot:
- P04844
- Synonyms:
- dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit;dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2;oligosaccharyltransferase complex subunit (non-catalytic);RIBIIR;Ribophorin II;ribophorin-2;RPN-II;RPNII;SWP1
- Extra Details:
- This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein is similar in sequence to the yeast oligosaccharyl transferase subunit SWP1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

