RPN2 Rabbit polyclonal antibody

Size

£151.00

SKU:: A8352
Additional Names:: RIBIIR|RPN-II|RPN2|RPNII|SWP1
Application:: ELISA, WB
Molecular Weight:: 69kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTV
Uniprot:: P04844
Synonyms:: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit;dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2;oligosaccharyltransferase complex subunit (non-catalytic);RIBIIR;Ribophorin II;ribophorin-2;RPN-II;RPNII;SWP1
Extra Details:: This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein is similar in sequence to the yeast oligosaccharyl transferase subunit SWP1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.