cGAS Rabbit polyclonal antibody

Size

£151.00

SKU:: A8335
Additional Names:: C6orf150|cGAS|h-cGAS|MB21D1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 62 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF
Uniprot:: Q8N884
Synonyms:: 2'3'-cGAMP synthase;C6orf150;cGAMP synthase;cyclic GMP-AMP synthase;h-cGAS;Mab-21 domain containing 1;mab-21 domain-containing protein 1;MB21D1;protein MB21D1
Extra Details:: Enables several functions, including 2',3'-cyclic GMP-AMP synthase activity; chromatin binding activity; and phosphatidylinositol-4,5-bisphosphate binding activity. Involved in several processes, including cellular response to exogenous dsRNA; positive regulation of intracellular signal transduction; and regulation of defense response. Located in several cellular components, including cytosol; nucleus; and site of double-strand break.