UBE2D4 Rabbit polyclonal antibody

Size

£151.00

SKU:: A8332
Additional Names:: HBUCE1|UBE2D4
Application:: ELISA, WB
Molecular Weight:: 17kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM
Uniprot:: Q9Y2X8
Synonyms:: E2 ubiquitin-conjugating enzyme D4;HBUCE1;ubiquitin carrier protein D4;ubiquitin conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2 D4;ubiquitin-conjugating enzyme HBUCE1;ubiquitin-protein ligase D4
Extra Details:: Enables ubiquitin conjugating enzyme activity. Involved in protein polyubiquitination. Acts upstream of or within protein ubiquitination. Predicted to be part of ubiquitin ligase complex. Predicted to be active in nucleus.