A8304
IL36G Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A8304
- Additional Names:
- IL-1F9|IL-1H1|IL-1RP2|IL1E|IL1F9|IL1H1|IL1RP2|IL36G
- Application:
- ELISA, WB
- Molecular Weight:
- 19kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
- Uniprot:
- Q9NZH8
- Synonyms:
- IL-1 related protein 2;IL-1-epsilon;IL-1-related protein 2;IL-1F9;IL-1H1;IL-1RP2;IL1E;IL1F9;IL1H1;IL1RP2;interleukin 1-related protein 2;interleukin-1 epsilon;interleukin-1 family member 9;interleukin-1 homolog 1;interleukin-36 gamma
- Extra Details:
- The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
- Shipping Conditions:
- Blue Ice

