A8282
DCP2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A8282
- Additional Names:
- DCP2|NUDT20
- Application:
- ELISA, WB
- Molecular Weight:
- 44kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLS
- Uniprot:
- Q8IU60
- Synonyms:
- DCP2 decapping enzyme homolog;hDpc;m7GpppN-mRNA hydrolase;mRNA-decapping enzyme 2;Nucleoside diphosphate-linked moiety X motif 20;nudix (nucleoside diphosphate linked moiety X)-type motif 20;NUDT20
- Extra Details:
- The protein encoded by this gene is a key component of an mRNA-decapping complex required for degradation of mRNAs, both in normal mRNA turnover, and in nonsense-mediated mRNA decay (NMD). It removes the 7-methyl guanine cap structure from mRNA, prior to its degradation from the 5' end. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
- Shipping Conditions:
- Blue Ice

