ULBP2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A8264
Additional Names:: ALCAN-alpha|N2DL2|NKG2DL2|RAET1H|RAET1L|ULBP2
Application:: ELISA, WB
Molecular Weight:: 35 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI
Uniprot:: Q9BZM5
Synonyms:: ALCAN-alpha;N2DL2;NKG2D ligand 2;NKG2DL2;RAET1H;RAET1L;retinoic acid early transcript 1H;retinoic acid early transcript 1L;UL16-binding protein 2
Extra Details:: This gene encodes a major histocompatibility complex (MHC) class I-related molecule that binds to the NKG2D receptor on natural killer (NK) cells to trigger release of multiple cytokines and chemokines that in turn contribute to the recruitment and activation of NK cells. The encoded protein undergoes further processing to generate the mature protein that is either anchored to membrane via a glycosylphosphatidylinositol moiety, or secreted. Many malignant cells secrete the encoded protein to evade immunosurveillance by NK cells. This gene is located in a cluster of multiple MHC class I-related genes on chromosome 6.