NDUFA12 Rabbit polyclonal antibody

Size

£152.00

SKU:: A8237
Additional Names:: B17.2|DAP13|MC1DN23|NDUFA12
Application:: ELISA, WB
Molecular Weight:: 17kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK
Uniprot:: Q9UI09
Synonyms:: 13 kDa differentiation-associated protein;B17.2;CI-B17.2;complex I B17.2 subunit;Complex I-B17.2;DAP13;MC1DN23;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12;NADH-ubiquinone oxidoreductase subunit B17.2
Extra Details:: This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants.