A8227
RNF31 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A8227
- Additional Names:
- HOIP|Paul|RNF31|ZIBRA
- Application:
- ELISA, WB
- Molecular Weight:
- 125kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECA
- Uniprot:
- Q96EP0
- Synonyms:
- E3 ubiquitin-protein ligase RNF31;HOIL-1-interacting protein;HOIP;Paul;RING finger protein 31;RING-type E3 ubiquitin transferase RNF31;ZIBRA;zinc in-between-RING-finger ubiquitin-associated domain protein
- Extra Details:
- The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. The encoded protein is the E3 ubiquitin-protein ligase component of the linear ubiquitin chain assembly complex. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice