IL36A Rabbit polyclonal antibody

Size

£152.00

SKU:: A8207
Additional Names:: FIL1|FIL1(EPSILON)|FIL1E|IL-1F6|IL1(EPSILON)|IL1F6|IL36A
Application:: ELISA, WB
Molecular Weight:: 23kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Uniprot:: Q9UHA7
Synonyms:: FIL1;FIL1 epsilon;FIL1(EPSILON);FIL1E;IL-1 epsilon;IL-1F6;IL-1F6 (FIL-1-epsilon);IL1(EPSILON);IL1F6;interleukin 1 family, member 6 (epsilon);interleukin-1 epsilon;interleukin-1 family member 6;interleukin-36 alpha
Extra Details:: The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients.