METTL7A Rabbit polyclonal antibody

Size

£152.00

SKU:: A8201
Additional Names:: AAM-B|AAMB|METTL7A
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 28 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: WICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK
Uniprot:: Q9H8H3
Synonyms:: AAM-B;AAMB;methyltransferase-like protein 7A;protein AAM-B
Extra Details:: Predicted to enable methyltransferase activity. Predicted to be involved in methylation. Located in lipid droplet.