IFI44 Rabbit polyclonal antibody

Size

£152.00

SKU:: A8188
Additional Names:: A430056A10Rik|IFI44|MTAP44|p44
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 50kda
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LFCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGPIGAGKSSFFNSVRSVFQGHVTHQALVGTNTTGISEKYRTYSIRDGKDGKYLPFILCDSLGLSEKEGGLCRDDIFYILNGNIRDRYQFNPMESIKLNHHDYIDSPS
Uniprot:: Q8TCB0
Synonyms:: A430056A10Rik;AW261460;interferon-induced protein 44;interferon-induced, hepatitis C-associated microtubular aggregate protein (44kD);microtubule-associated protein 44;MTAP;MTAP44;p4;p44;TBC/LysM-associated domain containing 5;TLDC5
Extra Details:: Acts upstream of or within response to bacterium. Predicted to be located in cytoplasm. Is expressed in central nervous system and retina. Orthologous to human IFI44 (interferon induced protein 44).