A8187
SLC9A6 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A8187
- Additional Names:
- MRSA|MRXSCH|NHE6|SLC9A6
- Application:
- ELISA, WB
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VDSDQEHLGVPENERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILNDGDISLTYGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA
- Uniprot:
- Q92581
- Synonyms:
- MRSA;MRXSCH;Na(+)/H(+) exchanger 6;NHE6;sodium/hydrogen exchanger 6;solute carrier family 9 (sodium/hydrogen exchanger), member 6;Solute carrier family 9 member 6;solute carrier family 9, subfamily A (NHE6, cation proton antiporter 6), member 6
- Extra Details:
- This gene encodes a sodium-hydrogen exchanger that is amember of the solute carrier family 9. The encoded protein localizes to early and recycling endosomes and may be involved in regulating endosomal pH and volume. Defects in this gene are associated with X-linked syndromic cognitive disability, Christianson type. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

