A8183
POP7 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A8183
- Additional Names:
- 0610037N12Rik|POP7|RPP2|RPP20
- Application:
- ELISA, WB
- Molecular Weight:
- 14kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
- Uniprot:
- O75817
- Synonyms:
- 0610037N12Rik;hPOP7;POP7 (processing of precursor, S. cerevisiae) homolog;processing of precursor 7, ribonuclease P subunit;processing of precursor 7, ribonuclease P/MRP subunit;ribonuclease P protein subunit p20;ribonucleases P/MRP protein subunit POP7 homolog;RNaseP protein p20;RPP2;RPP20
- Extra Details:
- Enables ribonuclease P RNA binding activity. Contributes to ribonuclease P activity. Involved in tRNA 5'-leader removal. Located in nucleolus. Part of multimeric ribonuclease P complex and ribonuclease MRP complex.
- Shipping Conditions:
- Blue Ice

