GPRC5A Rabbit polyclonal antibody

Size

£152.00

SKU:: A8173
Additional Names:: GPCR5A|GPRC5A|PEIG-1|RAI3|RAIG1|TIG1
Application:: ELISA, WB
Molecular Weight:: 37-50kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
Uniprot:: Q8NFJ5
Synonyms:: G-protein coupled receptor family C group 5 member A;GPCR5A;orphan G-protein-coupling receptor PEIG-1;PEIG-1;phorbol ester induced gene 1;phorbol ester induced protein-1;RAI3;RAIG1;retinoic acid induced 3;retinoic acid responsive;retinoic acid-induced gene 1 protein;retinoic acid-induced protein 3;TIG1;TPA induced gene 1
Extra Details:: This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation.