A8159
KDM6A Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A8159
- Additional Names:
- KDM6A|Utx
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 180kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPSVSQPGVHTACPRQTLANGPFSAGHVPCSTSRTLGSTDTVLIGNNHVTGSGSNGNVPYLQRNAPTLPHNRTNLTSSTEEPWKNQLSNSTQGLHKGPSSHLAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLS
- Synonyms:
- [histone H3]-trimethyl-L-lysine(27) demethylase 6A;bA386N14.2;bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeat protein (UTX));histone demethylase UTX;KABUK2;lysine (K)-specific demethylase 6A;lysine-specific demethylase 6A;ubiquitously transcribed tetratricopeptide repeat gene, X chromosome;ubiquitously transcribed tetratricopeptide repeat protein X-linked;ubiquitously transcribed TPR protein on the X chromosome;ubiquitously transcribed X chromosome tetratricopeptide repeat protein;ubiquitously-transcribed TPR gene on the X chromosome;UTX
- Extra Details:
- Enables DNA binding activity; histone H3-tri/di-methyl-lysine-27 demethylase activity; and identical protein binding activity. Involved in chromatin remodeling. Acts upstream of or within several processes, including chordate embryonic development; embryonic morphogenesis; and histone H3-K27 demethylation. Located in nucleus. Part of histone methyltransferase complex. Is expressed in several structures, including early conceptus; gonad; liver; lung; and spleen. Used to study chronic myelomonocytic leukemia. Human ortholog(s) of this gene implicated in several diseases, including Kabuki syndrome; bladder urothelial carcinoma; gastrointestinal system cancer (multiple); lung carcinoma (multiple); and triple-receptor negative breast cancer. Orthologous to human KDM6A (lysine demethylase 6A).
- Shipping Conditions:
- Blue Ice