USF2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A8158
Additional Names:: bHLHb12|FIP|USF2
Application:: ELISA, WB
Molecular Weight:: 40kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VVSTAAFAGGQQAVTQVGVDGAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMM
Uniprot:: Q15853
Synonyms:: bHLHb12;c-fos interacting protein;class B basic helix-loop-helix protein 12;FIP;FOS-interacting protein;major late transcription factor 2;upstream stimulatory factor 2;Upstream transcription factor 2
Extra Details:: This gene encodes a member of the basic helix-loop-helix leucine zipper family of transcription factors. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs and is involved in regulating multiple cellular processes.