TRPC6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A8155
Additional Names:: FSGS2|TRP6|TRPC6
Application:: ELISA, WB, IHC-P
Molecular Weight:: 106 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EGTKLLPNETSTDNAKQLFRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDANDTLK
Uniprot:: Q9Y210
Synonyms:: focal segmental glomerulosclerosis 2;FSGS2;short transient receptor potential channel 6;transient receptor protein 6;TRP-6;TRP6
Extra Details:: The protein encoded by this gene forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).