STXBP3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A8153
Additional Names:: MUNC18-3|MUNC18C|PSP|STXBP3|UNC-18C
Application:: ELISA, WB
Molecular Weight:: 68kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KQVVHLNLAEDCMNKFKLNIEKLCKTEQDLALGTDAEGQKVKDSMRVLLPVLLNKNHDNCDKIRAILLYIFSINGTTEENLDRLIQNVKIENESDMIRNWSYLGVPIVPQSQQGKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYCSQCPAVWNGSGAVSARQKPRANYLEDRKNGSKLIVFVIGGITYSEVRCAYEVSQAHKSCEVIIGSTHVLTPKKLLDDIKMLNKPKDKVSLIKDE
Uniprot:: O00186
Synonyms:: MUNC18-3;MUNC18C;platelet Sec1 protein;protein unc-18 homolog 3;protein unc-18 homolog C;PSP;syntaxin 4 binding protein;syntaxin-binding protein 3;UNC-18C;unc18-3
Extra Details:: Enables syntaxin binding activity. Involved in negative regulation of calcium ion-dependent exocytosis; neutrophil degranulation; and platelet aggregation. Located in cytosol; plasma membrane; and secretory granule. Is active in presynapse.