A8139
OXCT1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A8139
- Additional Names:
- OXCT|OXCT1|SCOT
- Application:
- ELISA, WB
- Molecular Weight:
- 56kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IPQIYVHRLIKGEKYEKRIERLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIAN
- Uniprot:
- P55809
- Synonyms:
- 3-oxoacid CoA transferase;3-oxoacid CoA-transferase 1;epididymis secretory sperm binding protein;OXCT;SCOT;SCOT-s;somatic-type succinyl-CoA:3-oxoacid CoA-transferase;succinyl CoA:3-oxoacid CoA transferase;succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial;succinyl-CoA:3-ketoacid-CoA transferase
- Extra Details:
- This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency.
- Shipping Conditions:
- Blue Ice

