NDUFA2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A8136
Additional Names:: B8|CD14|CIB8|MC1DN13|NDUFA2
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 11kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVL
Uniprot:: O43678
Synonyms:: B8;CD14;CIB8;complex I B8 subunit;Complex I-B8;MC1DN13;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2;NADH-ubiquinone oxidoreductase B8 subunit;NADH-ubiquinone oxidoreductase subunit CI-B8
Extra Details:: The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex 1), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane, and may be involved in regulating complex I activity or its assembly via assistance in redox processes. Mutations in this gene are associated with Leigh syndrome, an early-onset progressive neurodegenerative disorder. Alternative splicing results in multiple transcript variants.