A8134
MGAT3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A8134
- Additional Names:
- GNT-III|GNT3|MGAT3
- Application:
- ELISA, WB
- Molecular Weight:
- 61kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GCTVDMLQAVYGLDGIRLRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHFAGWHCSWCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKNYDRFHYLLDNPYQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV
- Uniprot:
- Q09327
- Synonyms:
- beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase;GlcNAc-T III;GNT-III;GNT3;mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase;N-acetylglucosaminyltransferase III;N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III
- Extra Details:
- There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. The enzyme encoded by this gene transfers a GlcNAc residue to the beta-linked mannose of the trimannosyl core of N-linked oligosaccharides and produces a bisecting GlcNAc. Multiple alternatively spliced variants, encoding the same protein, have been identified.
- Shipping Conditions:
- Blue Ice