HOXB5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A8123
Additional Names:: HHO.C10|HOX2|Hox2.1|HOX2A|HOXB5|HU-1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 29kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAFQP
Uniprot:: P09067
Synonyms:: HHO.C10;homeo box 2A;homeo box B5;homeobox protein HHO.C10;homeobox protein Hox-2A;homeobox protein Hox-B5;homeobox protein Hu-1;HOX2;Hox2.1;HOX2A;HU-1
Extra Details:: This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.