A8096
IL33 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A8096
- Additional Names:
- C9orf26|DVS27|IL1F11|IL33|NF-HEV|NFEHEV
- Application:
- ELISA, WB
- Molecular Weight:
- 33kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTK
- Uniprot:
- O95760
- Synonyms:
- C9orf26;DVS27;DVS27-related protein;IL1F11;interleukin-1 family member 11;interleukin-33;NF-HEV;NFEHEV;nuclear factor for high endothelial venules;nuclear factor from high endothelial venules
- Extra Details:
- The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice