NKX3-2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A8093
Additional Names:: BAPX1|NKX3-2|NKX3.2|NKX3B|SMMD
Application:: ELISA, WB
Molecular Weight:: 40kDa/46kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCCWRLFGERDAGALGGAEDSLLASPAGTRTAAGRTAESPEGWDSDSALSEENESRRRCADARGASGAGLAGGSLSLGQPVCELAASKDLEEEAAGRSDSEMSASVSGDRSPRTEDDGVGPRGAHVSALCSG
Uniprot:: P78367
Synonyms:: bagpipe homeobox protein homolog 1;BAPX1;homeobox protein NK-3 homolog B;homeobox protein Nkx-3.2;NKX3.2;NKX3B;SMMD
Extra Details:: Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in cell differentiation; negative regulation of chondrocyte differentiation; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including animal organ development; embryonic skeletal system development; and intestinal epithelial cell development. Predicted to be part of chromatin. Predicted to be active in nucleus.