A8059
MED24 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A8059
- Additional Names:
- ARC100|CRSP100|CRSP4|DRIP100|MED24|MED5|THRAP4|TRAP100
- Application:
- ELISA, WB
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKFDDFSRDLCVQALLDIMDMFCDRLSCHGKAEECIGLCRALLSALHWLLRCTAASAERLREGLEAGTPAAGEKQLAM
- Uniprot:
- O75448
- Synonyms:
- activator-recruited cofactor 100 kDa component;ARC100;cofactor required for Sp1 transcriptional activation subunit 4;cofactor required for Sp1 transcriptional activation, subunit 4, 100kDa;CRSP complex subunit 4;CRSP100;CRSP4;DRIP100;MED5;Mediator complex subunit 24;mediator of RNA polymerase II transcription subunit 24;mediator of RNA polymerase II transcription, subunit 24 homolog;THRAP4;thyroid hormone receptor-associated protein 4;thyroid hormone receptor-associated protein complex 100 kDa component;TRAP100;vitamin D3 receptor-interacting protein complex 100 kDa component;vitamin D3 receptor-interacting protein complex component DRIP100
- Extra Details:
- This gene encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, possibly by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice