A8056
RFC5 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A8056
- Additional Names:
- RFC36|RFC5
- Application:
- ELISA, WB
- Molecular Weight:
- 38kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA
- Uniprot:
- P40937
- Synonyms:
- A1 36 kDa subunit;Activator 1 36 kDa subunit;Activator 1 subunit 5;replication factor C (activator 1) 5, 36.5kDa;Replication factor C 36 kDa subunit;replication factor C subunit 5;replication factor C, 36-kDa subunit;RF-C 36 kDa subunit;RFC, 36.5 kD subunit;RFC36
- Extra Details:
- This gene encodes the smallest subunit of the replication factor C complex, which consists of five distinct subunits (140, 40, 38, 37, and 36 kDa) and is required for DNA replication. This subunit interacts with the C-terminal region of proliferating cell nuclear antigen and is required to open and load proliferating cell nuclear antigen onto DNA during S phase. It is a member of the AAA+ (ATPases associated with various cellular activities) ATPase family and forms a core complex with the 38 and 40 kDa subunits that possesses DNA-dependent ATPase activity. A related pseudogene has been identified on chromosome 9. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

