OSGEPL1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A8022
Additional Names:: OSGEPL|OSGEPL1|Qri7
Application:: ELISA, WB, IHC-P
Molecular Weight:: 45kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MLILTKTAGVFFKPSKRKVYEFLRSFNFHPGTLFLHKIVLGIETSCDDTAAAVVDETGNVLGEAIHSQTEVHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGLALSLGVGLSFSLQLVGQLKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGGKAIEHLAKQGNRFHFDIKPPLHHAKNCDFSFTGLQHVTDKIIMKKEKE
Uniprot:: Q9H4B0
Synonyms:: N6-L-threonylcarbamoyladenine synthase;O-sialoglycoprotein endopeptidase-like protein 1;OSGEPL;probable O-sialoglycoprotein endopeptidase 2;probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial;probable tRNA threonylcarbamoyladenosine biosynthesis protein OSGEPL1;putative sialoglycoprotease type 2;Qri7;t(6)A synthase;t(6)A37 threonylcarbamoyladenosine biosynthesis protein OSGEPL1;tRNA threonylcarbamoyladenosine biosynthesis protein OSGEPL1
Extra Details:: Predicted to enable N(6)-L-threonylcarbamoyladenine synthase activity and metal ion binding activity. Predicted to be involved in tRNA threonylcarbamoyladenosine modification. Located in mitochondrion.