NDUFS3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A8013
Additional Names:: CI-30|MC1DN8|NDUFS3
Application:: ELISA, WB, IP
Molecular Weight:: 26 kDa/30 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
Uniprot:: O75489
Synonyms:: CI-30;CI-30kD;complex I 30kDa subunit;complex I-30kD;MC1DN8;NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase);NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial;NADH dehydrogenase-ubiquinone 30 kDa subunit;NADH-ubiquinone oxidoreductase 30 kDa subunit
Extra Details:: This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.