A8002
EFHC1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A8002
- Additional Names:
- dJ304B14.2|EFHC1|EJM1|POC9|RIB72
- Application:
- ELISA, WB
- Molecular Weight:
- 74kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELIRMCSHGEGKINYYNFVRAFSN
- Uniprot:
- Q5JVL4
- Synonyms:
- dJ304B14.2;EF-hand domain (C-terminal) containing 1;EF-hand domain-containing protein 1;EJM1;myoclonin-1;POC9;RIB72
- Extra Details:
- This gene encodes an EF-hand-containing calcium binding protein. The encoded protein likely plays a role in calcium homeostasis. Mutations in this gene have been associated with susceptibility to juvenile myoclonic epilepsy and juvenile absence epilepsy. Alternatively spliced transcript variants have been described.
- Shipping Conditions:
- Blue Ice