USP26 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7999
Additional Names:: SPGFX6|USP26
Application:: ELISA, WB
Molecular Weight:: 104kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TSLCQFHKAGGKPASSPGTPLSKVDFQTVPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRPTKLNLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLKSGHYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRRCTGYIFFYMHNEIFEEMLKREENAQLNSKEVEETLQKE
Uniprot:: Q9BXU7
Synonyms:: deubiquitinating enzyme 26;ubiquitin carboxyl-terminal hydrolase 26;ubiquitin specific protease 26;ubiquitin thioesterase 26;ubiquitin thiolesterase 26;ubiquitin-specific processing protease 26;Ubiquitin-specific-processing protease 26
Extra Details:: This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases and is a deubiquitinating enzyme (DUB) with His and Cys domains. It is specifically expressed in testis tissue. Mutations in this gene have been associated with Sertoli cell-only syndrome and male infertility.