ATG9A Rabbit polyclonal antibody

Size

£152.00

SKU:: A7994
Additional Names:: APG9L1|ATG9A|mATG9|MGD3208
Application:: ELISA, WB
Molecular Weight:: 100 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: WQEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRI
Uniprot:: Q7Z3C6
Synonyms:: APG9 autophagy 9-like 1;APG9-like 1;APG9L1;ATG9 autophagy related 9 homolog A;autophagy 9-like 1 protein;autophagy-related protein 9A;mATG9;MGD3208
Extra Details:: Acts upstream of or within autophagosome assembly. Located in endosome; phagophore assembly site; and trans-Golgi network.