A7990
MCCC2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7990
- Additional Names:
- MCCB|MCCC2|MCCCbeta
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 61kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LHLTRKVVRNLNYQKKLDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIARIVDGSRFTEFKAFYGDTLVTGFARIFGYPVGIVGNNGVLFSESAKKGTHFVQLCCQRNIPLLFLQNITGFMVGREYEAEGIAKDGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAANVLATITKDQRAREGKQFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLVLGLSFSAALNAPIEKTDFGIFRM
- Uniprot:
- Q9HCC0
- Synonyms:
- 3-methylcrotonyl-CoA carboxylase 2;3-methylcrotonyl-CoA carboxylase non-biotin-containing subunit;3-methylcrotonyl-CoA:carbon dioxide ligase subunit beta;biotin carboxylase;MCCase subunit beta;MCCB;MCCCbeta;methylcrotonoyl-CoA carboxylase 2 (beta);methylcrotonoyl-CoA carboxylase beta chain, mitochondrial;methylcrotonoyl-Coenzyme A carboxylase 2 (beta);non-biotin containing subunit of 3-methylcrotonyl-CoA carboxylase;testicular secretory protein Li 29
- Extra Details:
- This gene encodes the small subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
- Shipping Conditions:
- Blue Ice








