A7988
LSM2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7988
- Additional Names:
- C6orf28|G7B|LSM2|snRNP|YBL026W
- Application:
- ELISA, WB
- Molecular Weight:
- 13kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
- Uniprot:
- Q9Y333
- Synonyms:
- C6orf28;G7B;LSM2 homolog, U6 small nuclear RNA associated;LSM2 U6 small nuclear RNA and mRNA degradation associated;protein G7b;small nuclear ribonuclear protein D homolog;snRNP;snRNP core Sm-like protein Sm-x5;U6 snRNA-associated Sm-like protein LSm2;YBL026W
- Extra Details:
- This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 19.
- Shipping Conditions:
- Blue Ice

