UCHL5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7978
Additional Names:: CGI-70|INO80R|UCH-L5|UCH37|UCHL5
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 38kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK
Uniprot:: Q9Y5K5
Synonyms:: CGI-70;INO80 complex subunit R;INO80R;ubiquitin C-terminal hydrolase UCH37;ubiquitin carboxyl-terminal esterase L5;ubiquitin carboxyl-terminal hydrolase isozyme L5;ubiquitin carboxyl-terminal hydrolase L5;ubiquitin thioesterase L5;UCH-L5;UCH37
Extra Details:: Enables endopeptidase inhibitor activity; proteasome binding activity; and thiol-dependent deubiquitinase. Involved in negative regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of smoothened signaling pathway; and protein deubiquitination. Located in cytosol; nucleolus; and nucleoplasm. Colocalizes with Ino80 complex.