B9D1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7973
Additional Names:: B9|B9D1|EPPB9|JBTS27|MKS9|MKSR-1|MKSR1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 23kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MATASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKL
Uniprot:: Q9UPM9
Synonyms:: B9;B9 domain-containing protein 1;B9 protein domain 1;endothelial precursor protein B9;EPPB9;JBTS27;MKS1-related protein 1;MKS9;MKSR-1;MKSR1
Extra Details:: This gene encodes a B9 domain-containing protein, one of several that are involved in ciliogenesis. Alterations in expression of this gene have been found in a family with Meckel syndrome. Meckel syndrome has been associated with at least six different genes. This gene is located within the Smith-Magenis syndrome region on chromosome 17.