FTSJ1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7967
Additional Names:: CDLIV|FTSJ1|JM23|MRX44|MRX9|SPB1|TRMT7|XLID9
Application:: ELISA, WB
Molecular Weight:: 36kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
Uniprot:: Q9UET6
Synonyms:: 2'-O-ribose RNA methyltransferase TRM7 homolog;CDLIV;cell division protein;FtsJ RNA methyltransferase homolog 1;FtsJ-like protein 1;JM23;MRX44;MRX9;Protein ftsJ homolog 1;putative ribosomal RNA methyltransferase 1;putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase;rRNA (uridine-2'-O-)-methyltransferase;SPB1;TRMT7;tRNA methyltransferase 7 homolog;XLID9
Extra Details:: This gene encodes a member of the methyltransferase superfamily. The encoded protein localizes to the nucleolus, binds to S-adenosylmethionine, and may be involved in the processing and modification of ribosomal RNA. Mutations in this gene are associated with cognitive disability. Alternative splicing results in multiple transcript variants.