ACSL6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7965
Additional Names:: ACS2|ACSL6|FACL6|LACS 6|LACS2|LACS5
Application:: ELISA, WB
Molecular Weight:: 77 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: YGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIKLVDVEELNYWACKGEGEICVRGPNVFKGYLKDPDRTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTNKDLKKAILEDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM
Uniprot:: Q9UKU0
Synonyms:: ACS2;arachidonate--CoA ligase;FACL6;fatty-acid-Coenzyme A ligase, long-chain 6;LACS 6;LACS2;LACS5;long fatty acyl-CoA synthetase 2;Long-chain acyl-CoA synthetase 6;long-chain-fatty-acid--CoA ligase 6
Extra Details:: The protein encoded by this gene catalyzes the formation of acyl-CoA from fatty acids, ATP, and CoA, using magnesium as a cofactor. The encoded protein plays a major role in fatty acid metabolism in the brain. Translocations with the ETV6 gene are causes of myelodysplastic syndrome with basophilia, acute myelogenous leukemia with eosinophilia, and acute eosinophilic leukemia. Several transcript variants encoding different isoforms have been found for this gene.