PRDM7 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7961
Additional Names:: PFM4|PRDM7|ZNF910
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 45kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NFFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRITEDEEAANSGYSWLITKGRNCYEYVDGKDK
Uniprot:: Q9NQW5
Synonyms:: PFM4;PR domain 7;PR domain containing 7;PR domain zinc finger protein 7;PR domain-containing protein 7;PR-domain family protein 4;probable histone-lysine N-methyltransferase PRDM7;ZNF910
Extra Details:: This gene encodes a member of a family of proteins that may have roles in transcription and other nuclear processes. The encoded protein contains a KRAB (Kruppel-associated box) domain -A box and a SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain and may function as a histone methyltransferase.